✍️Writing & Content50🎨Image Generation63🎬Video & Animation103🎵Audio & Music85💬Chatbots & Assistants81💻Coding & Development345📈Marketing & SEO117Productivity289🎯Design & UI/UX92📊Data & Analytics98📚Education & Research42💼Business & Finance108🏥Healthcare & Wellness19🔍Search & Knowledge20🤖AI Agent Infrastructure171🛡️AI Security & Testing26🧊3D & Spatial22🔎SEO Tools50🏡Real Estate6🗃️Data Extraction57🧠ADHD & Focus Tools11🔬Research & Academia26🧩LLM APIs & Models24⚙️Automation & Workflows23🔐Security & Privacy15📊Analytics & BI11⚖️Legal & Contracts9
💡

Complete Your Business Stack

Shipmail users also rely on these tools to enhance their workflow:

💰 Affiliate disclosure: We may earn a commission if you sign up through these links at no extra cost to you.

Listed in Business & Finance with 111 other toolsPart of 2036+ curated AI tools on AISO
Shipmail logo

Shipmail

Business email, newsletters and booking pages your agents can use via API and MCP

paidDR 1614-day free trial on all plans; features are identical across tiers. Solo $4/mo: 2 mailboxes, 15 GB each, 1 team member, 1,000 newsletter sends, 500 subscribers. Pro $9/mo: 4 mailboxes, up to 5 members, 5,000 sends, 2,500 subscribers. Team $29/mo: 12 mailboxes, 25 GB each, unlimited members, 25,000 sends, 10,000 subscribers. Scale covers 13–30 mailboxes. Yearly billing gives 2 months free. Up to 50 custom domains on every plan.View full pricing →

Visit Shipmail

https://shipmail.to

About Shipmail

Shipmail is business email on your own domain, built so that your agents can use the same inboxes you do. The product covers four things most small businesses otherwise assemble from separate vendors: real mailboxes, newsletters, transactional email and booking pages, all on one domain and one bill. You can use it as ordinary email in a normal client, work through a built-in AI assistant, or let an agent read and send from the same mailboxes through the API and an MCP server — which is the differentiator, because the usual choice is between a mail host with no programmatic surface and a transactional API with no actual inbox. The positioning is explicitly against Google Workspace and Microsoft 365 for founders and small teams, with three commitments that back it up: no lock-in, since your domain and mail move to any provider; privacy by design, with no scanning, no ads and no data sale; and independent verification, having been security audited twice by Radically Open Security. The site reports 3,700-plus users and a 4.9 rating. Pricing is unusual in that every plan has identical features and differs only in mailbox count, storage, team members, newsletter sends and subscriber limits, with up to 50 custom domains included on all of them — and there is a machine-readable pricing endpoint published specifically for AI agents.

ChatGPT already recommends Shipmail. Does it recommend yours?

If you're building in Business & Finance, run a free AI-visibility scan on your own product — we ask ChatGPT across 5 prompt angles and score how often you get named. ~30 seconds, no signup, no card.

Key Features

Mailboxes, newsletters and transactional email on one domain
API and MCP access to the same inboxes
Built-in AI assistant
Booking pages on your own domain
Up to 50 custom domains on every plan
Machine-readable pricing endpoint for agents

Shipmail Pros & Cons

Pros

  • +Same features on every tier — you only pay for capacity
  • +Twice independently security audited
  • +Agent access to real inboxes, not just a sending API

⚠️ Cons

  • No free tier beyond the 14-day trial
  • Mailbox caps mean larger teams jump tiers quickly
  • Smaller ecosystem than Workspace or Microsoft 365

Who Is Shipmail Best For?

👤Founders and small teams leaving Google Workspace
👤Builders who want agents reading and sending real email
👤Anyone running a newsletter and a business inbox on one domain

Tags

emailmcpapinewsletterprivacyagents
🏷️

Is Shipmail your tool?

This is the page buyers and AI assistants read when they look up Shipmail. Claim your listing for $19 one-time — no subscription, nothing to cancel — and get a Featured badge, top placement in your category, and a permanent dofollow backlink. Prefer it ongoing? Monthly is one click away on the next page.

Stay updated on Business & Finance tools — join our weekly newsletter

One concise email with fresh launches, trending picks, and featured standouts.

Alternatives to Shipmail

View all Shipmail alternatives →

Agent connectivity: not yet verified